DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb12 and NRPB12

DIOPT Version :9

Sequence 1:NP_001097319.1 Gene:Rpb12 / 5740790 FlyBaseID:FBgn0262954 Length:57 Species:Drosophila melanogaster
Sequence 2:NP_198917.1 Gene:NRPB12 / 834103 AraportID:AT5G41010 Length:51 Species:Arabidopsis thaliana


Alignment Length:50 Identity:27/50 - (54%)
Similarity:38/50 - (76%) Gaps:0/50 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     8 DNVKTAMTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKRLVVFDAR 57
            |.....:||:||:|..||.::..|.|:||||||||:|||||:|:|.::||
plant     2 DPAPEPVTYVCGDCGQENTLKSGDVIQCRECGYRILYKKRTRRVVQYEAR 51

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb12NP_001097319.1 RPOLCX 14..57 CDD:128906 24/42 (57%)
NRPB12NP_198917.1 RPOLCX 8..51 CDD:128906 24/42 (57%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 1 1.000 54 1.000 Domainoid score I4169
eggNOG 1 0.900 - - E1_COG1996
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 67 1.000 Inparanoid score I2494
OMA 1 1.010 - - QHG57717
OrthoDB 1 1.010 - - D1620152at2759
OrthoFinder 1 1.000 - - FOG0004951
OrthoInspector 1 1.000 - - otm3026
orthoMCL 1 0.900 - - OOG6_103748
Panther 1 1.100 - - LDO PTHR12056
Phylome 1 0.910 - -
SonicParanoid 1 1.000 - - X3493
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1312.840

Return to query results.
Submit another query.