powered by:
Protein Alignment Rpb12 and polr2k
DIOPT Version :9
Sequence 1: | NP_001097319.1 |
Gene: | Rpb12 / 5740790 |
FlyBaseID: | FBgn0262954 |
Length: | 57 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001016509.1 |
Gene: | polr2k / 549263 |
XenbaseID: | XB-GENE-854169 |
Length: | 58 |
Species: | Xenopus tropicalis |
Alignment Length: | 44 |
Identity: | 39/44 - (88%) |
Similarity: | 41/44 - (93%) |
Gaps: | 0/44 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 MTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKRLVVFDAR 57
|.|||||||.|||::.||||||||||||||||||||||||||||
Frog 15 MIYICGECHTENEIKARDPIRCRECGYRIMYKKRTKRLVVFDAR 58
|
Known Domains:
Indicated by green bases in alignment.
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
1 |
1.000 |
69 |
1.000 |
Domainoid score |
I9534 |
eggNOG |
0 | 0.000 |
Not matched by this tool. |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
1 |
1.050 |
89 |
1.000 |
Inparanoid score |
I4975 |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
1 |
1.010 |
- |
- |
|
D1620152at2759 |
OrthoFinder |
1 |
1.000 |
- |
- |
|
FOG0004951 |
OrthoInspector |
1 |
1.000 |
- |
- |
|
oto103135 |
Panther |
1 |
1.100 |
- |
- |
LDO |
PTHR12056 |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
1 |
1.030 |
- |
avgDist |
Average_Evolutionary_Distance |
R1178 |
SonicParanoid |
1 |
1.000 |
- |
- |
|
X3493 |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
8 | 8.190 |
|
Return to query results.
Submit another query.