DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb12 and POLR2K

DIOPT Version :9

Sequence 1:NP_001097319.1 Gene:Rpb12 / 5740790 FlyBaseID:FBgn0262954 Length:57 Species:Drosophila melanogaster
Sequence 2:NP_005025.1 Gene:POLR2K / 5440 HGNCID:9198 Length:58 Species:Homo sapiens


Alignment Length:44 Identity:39/44 - (88%)
Similarity:41/44 - (93%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKRLVVFDAR 57
            |.|||||||.|||::.||||||||||||||||||||||||||||
Human    15 MIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR 58

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb12NP_001097319.1 RPOLCX 14..57 CDD:128906 37/42 (88%)
POLR2KNP_005025.1 RPOLCX 15..58 CDD:128906 37/42 (88%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C165160046
Domainoid 1 1.000 69 1.000 Domainoid score I9677
eggNOG 1 0.900 - - E1_COG1996
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 89 1.000 Inparanoid score I5126
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57717
OrthoDB 1 1.010 - - D1620152at2759
OrthoFinder 1 1.000 - - FOG0004951
OrthoInspector 1 1.000 - - oto89300
orthoMCL 1 0.900 - - OOG6_103748
Panther 1 1.100 - - LDO PTHR12056
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1178
SonicParanoid 1 1.000 - - X3493
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
User_Submission 00.000 Not matched by this tool.
1514.800

Return to query results.
Submit another query.