Sequence 1: | NP_001097319.1 | Gene: | Rpb12 / 5740790 | FlyBaseID: | FBgn0262954 | Length: | 57 | Species: | Drosophila melanogaster |
---|---|---|---|---|---|---|---|---|---|
Sequence 2: | NP_005025.1 | Gene: | POLR2K / 5440 | HGNCID: | 9198 | Length: | 58 | Species: | Homo sapiens |
Alignment Length: | 44 | Identity: | 39/44 - (88%) |
---|---|---|---|
Similarity: | 41/44 - (93%) | Gaps: | 0/44 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 14 MTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKRLVVFDAR 57 |
Gene | Sequence | Domain | Region | External ID | Identity |
---|---|---|---|---|---|
Rpb12 | NP_001097319.1 | RPOLCX | 14..57 | CDD:128906 | 37/42 (88%) |
POLR2K | NP_005025.1 | RPOLCX | 15..58 | CDD:128906 | 37/42 (88%) |
Tool | Simple Score | Weighted Score | Original Tool Information | |||
---|---|---|---|---|---|---|
BLAST Result | Score | Score Type | Cluster ID | |||
Compara | 1 | 0.930 | - | - | C165160046 | |
Domainoid | 1 | 1.000 | 69 | 1.000 | Domainoid score | I9677 |
eggNOG | 1 | 0.900 | - | - | E1_COG1996 | |
Hieranoid | 1 | 1.000 | - | - | ||
Homologene | 0 | 0.000 | Not matched by this tool. | |||
Inparanoid | 1 | 1.050 | 89 | 1.000 | Inparanoid score | I5126 |
Isobase | 0 | 0.000 | Not matched by this tool. | |||
OMA | 1 | 1.010 | - | - | QHG57717 | |
OrthoDB | 1 | 1.010 | - | - | D1620152at2759 | |
OrthoFinder | 1 | 1.000 | - | - | FOG0004951 | |
OrthoInspector | 1 | 1.000 | - | - | oto89300 | |
orthoMCL | 1 | 0.900 | - | - | OOG6_103748 | |
Panther | 1 | 1.100 | - | - | LDO | PTHR12056 |
Phylome | 1 | 0.910 | - | - | ||
RoundUp | 1 | 1.030 | - | avgDist | Average_Evolutionary_Distance | R1178 |
SonicParanoid | 1 | 1.000 | - | - | X3493 | |
SwiftOrtho | 0 | 0.000 | Not matched by this tool. | |||
TreeFam | 1 | 0.960 | - | - | ||
User_Submission | 0 | 0.000 | Not matched by this tool. | |||
15 | 14.800 |