DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Rpb12 and rpb-12

DIOPT Version :9

Sequence 1:NP_001097319.1 Gene:Rpb12 / 5740790 FlyBaseID:FBgn0262954 Length:57 Species:Drosophila melanogaster
Sequence 2:NP_501593.1 Gene:rpb-12 / 184886 WormBaseID:WBGene00009078 Length:62 Species:Caenorhabditis elegans


Alignment Length:45 Identity:32/45 - (71%)
Similarity:41/45 - (91%) Gaps:0/45 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 AMTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKRLVVFDAR 57
            :|.|||||||.|||::|:|.||||||||||:||||.::|:|:|||
 Worm    18 SMIYICGECHAENEIKPKDAIRCRECGYRILYKKRCRKLMVYDAR 62

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Rpb12NP_001097319.1 RPOLCX 14..57 CDD:128906 30/42 (71%)
rpb-12NP_501593.1 RPOLCX 19..62 CDD:128906 30/42 (71%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C160162506
Domainoid 1 1.000 67 1.000 Domainoid score I6487
eggNOG 1 0.900 - - E1_COG1996
Hieranoid 1 1.000 - -
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 81 1.000 Inparanoid score I3792
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG57717
OrthoDB 1 1.010 - - D1620152at2759
OrthoFinder 1 1.000 - - FOG0004951
OrthoInspector 1 1.000 - - oto18442
orthoMCL 1 0.900 - - OOG6_103748
Panther 1 1.100 - - LDO PTHR12056
Phylome 1 0.910 - -
RoundUp 1 1.030 - avgDist Average_Evolutionary_Distance R1178
SonicParanoid 1 1.000 - - X3493
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
1514.800

Return to query results.
Submit another query.