DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Polr2K and Polr2k

DIOPT Version :10

Sequence 1:NP_001097319.1 Gene:Polr2K / 5740790 FlyBaseID:FBgn0262954 Length:57 Species:Drosophila melanogaster
Sequence 2:NP_001034457.1 Gene:Polr2k / 17749 MGIID:102725 Length:99 Species:Mus musculus


Alignment Length:44 Identity:39/44 - (88%)
Similarity:41/44 - (93%) Gaps:0/44 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 MTYICGECHHENEMRPRDPIRCRECGYRIMYKKRTKRLVVFDAR 57
            |.|||||||.|||::.||||||||||||||||||||||||||||
Mouse    56 MIYICGECHTENEIKSRDPIRCRECGYRIMYKKRTKRLVVFDAR 99

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Polr2KNP_001097319.1 RPOLCX 14..57 CDD:128906 37/42 (88%)
Polr2kNP_001034457.1 RPOLCX 56..99 CDD:128906 37/42 (88%)

Return to query results.
Submit another query.