DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34214 and RBM28

DIOPT Version :10

Sequence 1:NP_001097444.1 Gene:CG34214 / 5740774 FlyBaseID:FBgn0085243 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_060547.2 Gene:RBM28 / 55131 HGNCID:21863 Length:759 Species:Homo sapiens


Alignment Length:93 Identity:22/93 - (23%)
Similarity:36/93 - (38%) Gaps:20/93 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KLPPDANIRYAEWRIITGDMELF-QVQGVRFDKIMLVLGEENISWVFYQNTPLFRRIEGSACFPV 120
            :|||.|.....|        ||| ||..|:...::...|.:......|....:...::.:.....
Human    10 RLPPSARSEQLE--------ELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRALKEIT 66

  Fly   121 SYCGCCLNNQYLDIMAKIKQTVSRKKIR 148
            ::.||           ||..||::||:|
Human    67 TFEGC-----------KINVTVAKKKLR 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34214NP_001097444.1 None
RBM28NP_060547.2 RRM1_RBM28_like 5..81 CDD:409847 19/89 (21%)
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 84..105 22/93 (24%)
RRM2_RBM28_like 115..190 CDD:409848
PABP-1234 126..721 CDD:130689
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 201..330
RRM3_RBM28_like 335..417 CDD:409849
RRM4_RBM28_like 487..581 CDD:409850
Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 594..759
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.