DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34214 and rbm28

DIOPT Version :9

Sequence 1:NP_001097444.1 Gene:CG34214 / 5740774 FlyBaseID:FBgn0085243 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_956615.1 Gene:rbm28 / 393291 ZFINID:ZDB-GENE-040426-960 Length:864 Species:Danio rerio


Alignment Length:117 Identity:25/117 - (21%)
Similarity:46/117 - (39%) Gaps:37/117 - (31%)


- Green bases have known domain annotations that are detailed below.


  Fly    53 RERSKLPPDANIRYAEWRIITGDMELFQVQGVRFD-------KIMLVLGEENISWVFYQNTP--- 107
            ::|:.||.|.|    |.|.|.       ::.:.||       :::|..||  :|:|.....|   
Zfish   425 KKRNPLPSDVN----EGRTIF-------IRNLSFDSEEEGLEEVLLQFGE--LSYVRVVMNPDTG 476

  Fly   108 --------LFRRIEGS-ACFPVS-----YCGCCLNNQYLDIMAKIKQTVSRK 145
                    .|:..|.: .|...:     :.|..|:.:.|:|:..|.:..:.|
Zfish   477 VSKGCAFAQFKSKEAAEKCIAAALDEKEFSGIKLDGRRLNILMAINRDDAAK 528

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34214NP_001097444.1 None
rbm28NP_956615.1 ELAV_HUD_SF 2..316 CDD:273741
RRM1_RBM28_like 5..77 CDD:240859
RRM2_RBM28_like 126..198 CDD:240860
RRM2_RBM28_like 237..312 CDD:240860
RRM3_RBM28_like 438..520 CDD:240861 17/90 (19%)
RRM4_RBM28_like 590..683 CDD:240862
Blue background indicates that the domain is not in the aligned region.


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG0127
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.