DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34214 and Rbm28

DIOPT Version :10

Sequence 1:NP_001097444.1 Gene:CG34214 / 5740774 FlyBaseID:FBgn0085243 Length:148 Species:Drosophila melanogaster
Sequence 2:NP_001402807.1 Gene:Rbm28 / 312182 RGDID:1311336 Length:753 Species:Rattus norvegicus


Alignment Length:93 Identity:20/93 - (21%)
Similarity:36/93 - (38%) Gaps:20/93 - (21%)


- Green bases have known domain annotations that are detailed below.


  Fly    57 KLPPDANIRYAEWRIITGDMELF-QVQGVRFDKIMLVLGEENISWVFYQNTPLFRRIEGSACFPV 120
            :|||.|.....|        ||| ||..|:...::...|.:......|....:...::.:.....
  Rat    10 RLPPSARSDQLE--------ELFSQVGPVKQCFVVTEKGSKACRGFGYVTFSMLEDVQRALKEIT 66

  Fly   121 SYCGCCLNNQYLDIMAKIKQTVSRKKIR 148
            ::.||           ||..|:::||::
  Rat    67 TFEGC-----------KINVTIAKKKLK 83

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34214NP_001097444.1 None
Rbm28NP_001402807.1 RRM1_RBM28_like 5..78 CDD:409847 18/86 (21%)
RRM2_RBM28_like 115..190 CDD:409848
PABP-1234 322..709 CDD:130689
RRM3_RBM28_like 329..411 CDD:409849
RRM4_RBM28_like 481..575 CDD:409850
Blue background indicates that the domain is not in the aligned region.

Return to query results.
Submit another query.