DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34313 and Chst9

DIOPT Version :9

Sequence 1:NP_001097169.1 Gene:CG34313 / 5740766 FlyBaseID:FBgn0085342 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_951010.1 Gene:Chst9 / 71367 MGIID:1918617 Length:413 Species:Mus musculus


Alignment Length:203 Identity:39/203 - (19%)
Similarity:74/203 - (36%) Gaps:61/203 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly    13 KGSHMEPSTRKEKRTERN---NVLTYKK-------LRKMPLN---------LRKQAVREARNRNE 58
            |.||.:......:.||.:   .:..::|       |...|||         .:..|.:|.|....
Mouse    88 KISHSQRENGAYRSTEAHQGAKIEVFQKPIQMDWPLVTQPLNKSLVQGNKWKKADATQEKRRSFL 152

  Fly    59 PILGKKKKRKTNPRF--FRTARRLRNDFDRSEHKAMLASTSE----ELRRILQDVETLS----DI 113
            ....||..|..:|:|  |....|:   :...:||.:.....:    ..:|||..:..|:    :|
Mouse   153 HEFCKKYGRVNDPKFNLFHIVSRI---YVEDKHKILYCEVPKAGCSNWKRILMVLNGLASSAYNI 214

  Fly   114 PHD----------ITNVELQGEIAIAEGRATTIYVQRDGLSTLTVVLHQHEPTIAQLKRAI-ALI 167
            .||          :.:.:|:|           ::::   |:|.|..:...:|    ::|.: |..
Mouse   215 SHDTVHYGKHLKTLDSFDLKG-----------VHMR---LNTYTKAVFVRDP----MERLVSAFR 261

  Fly   168 SRAQHKRS 175
            .:.:|..|
Mouse   262 DKFEHPNS 269

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34313NP_001097169.1 None
Chst9NP_951010.1 Sulfotransfer_2 179..408 CDD:281554 19/109 (17%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.