DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34313 and Chst14

DIOPT Version :9

Sequence 1:NP_001097169.1 Gene:CG34313 / 5740766 FlyBaseID:FBgn0085342 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001103109.1 Gene:Chst14 / 691394 RGDID:1585023 Length:375 Species:Rattus norvegicus


Alignment Length:165 Identity:33/165 - (20%)
Similarity:59/165 - (35%) Gaps:40/165 - (24%)


- Green bases have known domain annotations that are detailed below.


  Fly    89 HK-AMLASTSEELRRILQDVETLSD--IPHDITNVELQG------------EIAIAEGRATTIYV 138
            || |..:.|..:.|.:..|.|. ||  :..||.|..|:.            ::.:.:.|....::
  Rat    78 HKGAAWSGTDPKPRGLSFDAED-SDLQVREDIRNRTLRAVCGQPGMPRDPWDLPVGQRRTLLRHI 141

  Fly   139 QRDGLSTLTVVLHQHEPTIA--QLKRAIALISRAQHKRSQRERCEERLRRRGIADDSDER----- 196
            .   :|.....|:.:.|.:|  ..||.:.:::...:....|.:.:.|.....:||...|.     
  Rat   142 L---VSDRYRFLYCYVPKVACSNWKRVLKVLAGVLNNVDVRLKMDHRSDLVFLADLRPEEIRYRL 203

  Fly   197 ---------RQPV-----AVASSTGELVHSAQRNG 217
                     |.|:     |..:..||:....||.|
  Rat   204 QHYFKFLFVRDPLERLLSAYRNKFGEIREYQQRYG 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34313NP_001097169.1 None
Chst14NP_001103109.1 Sulfotransfer_2 144..364 CDD:281554 19/95 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.