DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34313 and Chst8

DIOPT Version :9

Sequence 1:NP_001097169.1 Gene:CG34313 / 5740766 FlyBaseID:FBgn0085342 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_780349.3 Gene:Chst8 / 68947 MGIID:1916197 Length:417 Species:Mus musculus


Alignment Length:239 Identity:52/239 - (21%)
Similarity:84/239 - (35%) Gaps:46/239 - (19%)


- Green bases have known domain annotations that are detailed below.


  Fly     7 KDRSPFKGSHMEPSTRKEKR-----TERNNVL-------TYKKLRKMPLNLRKQAVREARNRNEP 59
            :.:.|...||:..||.|..|     :.|...|       .:.|....||.|| |..|....:..|
Mouse    50 RPQQPQHDSHLRISTEKGTRDSPSGSPRGLQLQAPDQPRPHPKAAGSPLRLR-QRRRRLLIKKMP 113

  Fly    60 ILGKKKKRKTNPRFFRTARRLRNDFDRSEHKAMLASTSEELRRILQDV--------ETLSDIPHD 116
            ..|..:...::..|.:...|..:....|.|:     |.:|.:|::::.        ...:..|..
Mouse   114 AAGTNQGNNSSETFIQPRPRTMDSRWVSLHQ-----TQQERKRVMREACAKYRASSSRRAVTPRH 173

  Fly   117 ITNVELQGEIAIAEGRATTIY--VQRDGLSTLTVVLHQHEPTIAQLKRAIALISRAQHKRSQRER 179
            ::.:       ..|.|...:|  |.:.|.|....||    ..:|.|..:.|.|   ||.......
Mouse   174 VSRI-------FVEDRHRVLYCEVPKAGCSNWKRVL----MVLAGLASSTADI---QHNTVHYGS 224

  Fly   180 CEERL---RRRGIADDSDERRQPVAVASSTGELVHSAQRNGHDH 220
            ..:||   .|:||........:.:.|......|| ||.|:..:|
Mouse   225 ALKRLDTFDRQGIVHRLSTYTKMLFVREPFERLV-SAFRDKFEH 267

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34313NP_001097169.1 None
Chst8NP_780349.3 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..101 12/50 (24%)
Sulfotransfer_2 180..409 CDD:367564 26/96 (27%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.