DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34313 and CHST8

DIOPT Version :9

Sequence 1:NP_001097169.1 Gene:CG34313 / 5740766 FlyBaseID:FBgn0085342 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001121367.1 Gene:CHST8 / 64377 HGNCID:15993 Length:424 Species:Homo sapiens


Alignment Length:195 Identity:39/195 - (20%)
Similarity:70/195 - (35%) Gaps:52/195 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 MEPSTRKEKRTERNNVLTYKKLRKMP---------------------LNLRKQAVREARNRNEPI 60
            ::..||...|..|..:|    ::|||                     |:.|..::..::...:.:
Human    99 LQRGTRLRLRQRRRRLL----IKKMPAAATIPANSSDAPFIRPGPGTLDGRWVSLHRSQQERKRV 159

  Fly    61 LGK--KKKRKTNPRFFRTARRLRNDFDRSEHKAMLASTSE----ELRRILQDVETL----SDIPH 115
            :.:  .|.|.::.|...|.|.:...|....|:.:.....:    ..:|:|..:..|    :||.|
Human   160 MQEACAKYRASSSRRAVTPRHVSRIFVEDRHRVLYCEVPKAGCSNWKRVLMVLAGLASSTADIQH 224

  Fly   116 DITNVELQGEIAIAEGRATTIYVQRDG----LSTLTVVLHQHEPTIAQLKRAI-ALISRAQHKRS 175
            :..:      ...|..|..|.  .|.|    |||.|.:|...||    .:|.: |...:.:|..|
Human   225 NTVH------YGSALKRLDTF--DRQGILHRLSTYTKMLFVREP----FERLVSAFRDKFEHPNS 277

  Fly   176  175
            Human   278  277

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34313NP_001097169.1 None
CHST8NP_001121367.1 Disordered. /evidence=ECO:0000256|SAM:MobiDB-lite 47..107 2/7 (29%)
Sulfotransfer_2 187..416 CDD:308913 23/103 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.