DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34313 and snrnp25

DIOPT Version :9

Sequence 1:NP_001097169.1 Gene:CG34313 / 5740766 FlyBaseID:FBgn0085342 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001017690.1 Gene:snrnp25 / 550385 ZFINID:ZDB-GENE-050417-179 Length:173 Species:Danio rerio


Alignment Length:218 Identity:51/218 - (23%)
Similarity:87/218 - (39%) Gaps:51/218 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    56 RNEPILGKKKKRKTNPRFFRTARRLRNDFDRSEHKAMLASTSEELRRILQDVETLSDIPHDITNV 120
            ::|..|.|:.:.||.....:.......|.:...|..:|....|.|..|:|| ..|.|:|..:|..
Zfish     5 KDETELKKELEEKTVEDEIKEEHEEEEDEEALPHSEILDIFEEGLALIVQD-PLLCDLPIQVTLE 68

  Fly   121 ELQGEIAIAEGRATTIYVQRDGLSTLTVVLHQHEPTIAQLKRAIALISRAQHKRSQRERCEERLR 185
            |:..::|:..|:|.|:.|.:.....:.:|:.| ..|:..||:|   |.|....:.|||       
Zfish    69 EVNSQVALEYGQAMTVRVCKADGEVMPIVVVQ-SATVLDLKKA---IRRYMELKQQRE------- 122

  Fly   186 RRGIADDSDERRQPVAVASSTGELVHSAQRNGHDHRAFVSWRFLWRCFGLLNVDTNQPIDDQRSS 250
                                 |.:.|            |||:::||.|.|  |...:.::|.|..
Zfish   123 ---------------------GGVKH------------VSWKYVWRTFHL--VFNGEKLEDDRRK 152

  Fly   251 GRATLKELGIENAATLKFVHRVK 273
                ||:.|:.|...:.|..:::
Zfish   153 ----LKDYGVRNRDEVTFSKKLR 171



Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006151
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
21.910

Return to query results.
Submit another query.