DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34313 and snrnp25

DIOPT Version :9

Sequence 1:NP_001097169.1 Gene:CG34313 / 5740766 FlyBaseID:FBgn0085342 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_012825889.1 Gene:snrnp25 / 549456 XenbaseID:XB-GENE-991381 Length:175 Species:Xenopus tropicalis


Alignment Length:195 Identity:48/195 - (24%)
Similarity:82/195 - (42%) Gaps:52/195 - (26%)


- Green bases have known domain annotations that are detailed below.


  Fly    80 LRNDFDRS-EHKAMLASTSEELRRILQDVETLSDIPHDITNVELQGEIAIAEGRATTIYVQRDGL 143
            ::.|.|.. .|..::....|.|..|:|| ..|.|:|..:|..|:..:||:..|:|.|:.|.:...
 Frog    30 VKQDVDEELPHAEVVDIFQEGLAMIVQD-PLLCDLPIQVTLEEINSQIALEYGQAMTVRVCKADG 93

  Fly   144 STLTVVLHQHEPTIAQLKRAIALISRAQHKRSQRERCEERLRRRGIADDSDERRQPVAVASSTGE 208
            ..:.||:.|: .|:..|||||....:.:|:|.                               |.
 Frog    94 EIMPVVVVQN-ATVLDLKRAIQRYIQLKHQRE-------------------------------GG 126

  Fly   209 LVHSAQRNGHDHRAFVSWRFLWRCFGLLNVDTNQPIDDQRSSGRATLKELGIENAATLKFVHRVK 273
            :.|            :||:::||.:. |:....:..:|.||     |:|.||:|...:.||.::|
 Frog   127 IQH------------ISWKYVWRTYH-LSFSGEKLEEDSRS-----LREYGIKNRDEVVFVKKLK 173

  Fly   274  273
             Frog   174  173

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34313NP_001097169.1 None
snrnp25XP_012825889.1 Ubl_SNRNP25 83..171 CDD:340578 31/137 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 1 1.050 45 1.000 Inparanoid score I5300
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006151
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
22.050

Return to query results.
Submit another query.