DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34313 and chst10

DIOPT Version :9

Sequence 1:NP_001097169.1 Gene:CG34313 / 5740766 FlyBaseID:FBgn0085342 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_005159945.1 Gene:chst10 / 445322 ZFINID:ZDB-GENE-040808-40 Length:399 Species:Danio rerio


Alignment Length:166 Identity:28/166 - (16%)
Similarity:53/166 - (31%) Gaps:42/166 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    76 TARRLRND--FDRSEHKAMLASTSEELRRILQDVETLSDIPHDITNVELQGEIAIAEGRATTIYV 138
            |.|:...|  |...:||.:...|.:                  :.|.:.:..:.:..|:.:.:..
Zfish   143 TVRKFVLDRIFVCDKHKILFCQTPK------------------VGNTQWKKVLIVLNGKFSKVEA 189

  Fly   139 QRDGLSTLTVVLHQHEPTIAQLKRAIALISRAQHKRSQR-----------ERCEERLRRRGIADD 192
            ..:.|      :|.||..  .|.|..::.....|:|...           ||.....:.:.:   
Zfish   190 IPENL------VHDHERN--GLPRLSSMTDTEIHQRLNSYFKFFIVRDPFERLISAFKDKFV--- 243

  Fly   193 SDERRQPVAVASSTGELVHSAQRNGHDHRAFVSWRF 228
            .:.|.:|.........:|...:|:.||....|..||
Zfish   244 KNPRFEPWYKHDIAPAIVRKYRRSHHDDSESVGLRF 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34313NP_001097169.1 None
chst10XP_005159945.1 Sulfotransfer_2 155..391 CDD:281554 24/154 (16%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
ZFIN 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.