powered by:
Protein Alignment CG34313 and chst11
DIOPT Version :9
Sequence 1: | NP_001097169.1 |
Gene: | CG34313 / 5740766 |
FlyBaseID: | FBgn0085342 |
Length: | 281 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_997989.2 |
Gene: | chst11 / 404232 |
ZFINID: | ZDB-GENE-040315-1 |
Length: | 352 |
Species: | Danio rerio |
Alignment Length: | 42 |
Identity: | 11/42 - (26%) |
Similarity: | 17/42 - (40%) |
Gaps: | 5/42 - (11%) |
- Green bases have known domain annotations that are detailed below.
Fly 186 RRGIADDSDERRQPVAVASSTGELVHSAQRNG-----HDHRA 222
|:|..:...|...|.....|...::|.|:|:. |.|.|
Zfish 53 RKGSRNALQELYNPTQAEFSAAAVLHQARRDQVAETCHAHSA 94
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34313 | NP_001097169.1 |
None |
chst11 | NP_997989.2 |
Sulfotransfer_2 |
113..343 |
CDD:281554 |
|
Blue background indicates that the domain is not in
the aligned region.
|
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4651 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
ZFIN |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.