DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34313 and CG31743

DIOPT Version :9

Sequence 1:NP_001097169.1 Gene:CG34313 / 5740766 FlyBaseID:FBgn0085342 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001286000.1 Gene:CG31743 / 326156 FlyBaseID:FBgn0032618 Length:329 Species:Drosophila melanogaster


Alignment Length:279 Identity:61/279 - (21%)
Similarity:110/279 - (39%) Gaps:72/279 - (25%)


- Green bases have known domain annotations that are detailed below.


  Fly    30 NNV-LTYKKLR-KMPLNLRKQAVREARNRNEPILGKKKKRKTNPRFFRTARRLRND---FDRSEH 89
            ||| :|.:.|. ...:|:::|   |...|...:||      .:.:.......|:.|   .|: ||
  Fly    33 NNVKITRRSLELTQTINIQRQ---EFMQRQCELLG------DHTQTLEDLSELQMDHMIVDK-EH 87

  Fly    90 KAM------LASTSEELRRILQDVETLSDIPHDITN-VELQGEIAIAEGRATTIY---------V 138
            |.:      :|.|:  .:|:|.   .|::..|:.|: :::.|.:|.:.|..|.:|         |
  Fly    88 KLLYCYVPKVACTN--WKRVLM---MLTNKWHNGTDPLQIPGSLAHSVGMFTKLYDLSEAEQQQV 147

  Fly   139 QRDGLSTLTVVLHQHEPTIAQLKRAIALIS-RAQHKRSQRERCEERLRRRGIADDSDERRQPVAV 202
            ..|..:...:|.|..|..::..:..:...| .|::.:|:..|...:..|.|.:::|.||...|:.
  Fly   148 LSDEYTRFILVRHPLERLLSAYRNKLEGDSPSARYFQSRVGRQIVKELRPGASNNSLERGDDVSF 212

  Fly   203 AS-----STGELVHSAQRNGHDHRAFVSWRFLWR----CFGLLNV----DT-------------- 240
            ..     .|.||..:.|.:.::|     |..:.:    |....||    ||              
  Fly   213 GEFIQYLVTPELSRANQSDYNEH-----WEVIAKLCNPCVMKYNVVGKYDTLLDDSALALYLAGA 272

  Fly   241 ---NQPIDDQRSSGRATLK 256
               ..|...:.||.||.|:
  Fly   273 DNLTFPTGHKPSSTRANLR 291

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34313NP_001097169.1 None
CG31743NP_001286000.1 Sulfotransfer_2 84..318 CDD:281554 48/219 (22%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.