DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34313 and Chst12

DIOPT Version :9

Sequence 1:NP_001097169.1 Gene:CG34313 / 5740766 FlyBaseID:FBgn0085342 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_001032864.1 Gene:Chst12 / 304322 RGDID:1308214 Length:419 Species:Rattus norvegicus


Alignment Length:237 Identity:51/237 - (21%)
Similarity:73/237 - (30%) Gaps:103/237 - (43%)


- Green bases have known domain annotations that are detailed below.


  Fly    16 HMEPSTRKEKRTERNNVLTYKK--LRKMPLNLR--KQAVREARNRNEPILGKKKKRKTNPRFFRT 76
            |.:.|.||   ||:..|||..|  |..|..|:|  ..:..:|:.              ||     
  Rat    78 HNDLSRRK---TEQPPVLTPSKPVLSHMEENVRGYDWSTHDAQQ--------------NP----- 120

  Fly    77 ARRLRNDFDRSEHKAMLASTSEELRRILQDV------------ETLSDIPHDITNVELQGEIAIA 129
                    ||...:|       |.|.:|:|.            .:..|||    |.||..  .|.
  Rat   121 --------DRDRQQA-------ERRSLLRDFCANASLAFPTKDRSFDDIP----NYELNH--LIV 164

  Fly   130 EGRATTIYVQRDGLSTLTVVLHQHEPTIA--QLKRAIALISRAQHKRSQRERCEERLRRRGIADD 192
            :.|...||.              :.|.:|  ..||.:.::|.:                  :.|.
  Rat   165 DDRHGVIYC--------------YVPKVACTNWKRVMIVLSES------------------LLDR 197

  Fly   193 SDERRQPVAVASSTGELVHSAQRNGHDHRAFVSWRFLWRCFG 234
            ....|.|:.:..   |.||    |...|..|..:   ||.:|
  Rat   198 GSPYRDPLDIPR---EHVH----NTSTHLTFNKF---WRRYG 229

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34313NP_001097169.1 None
Chst12NP_001032864.1 Sulfotransfer_2 165..410 CDD:397568 20/107 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.