DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34313 and Snrnp25

DIOPT Version :9

Sequence 1:NP_001097169.1 Gene:CG34313 / 5740766 FlyBaseID:FBgn0085342 Length:281 Species:Drosophila melanogaster
Sequence 2:XP_006246141.1 Gene:Snrnp25 / 287170 RGDID:1310922 Length:123 Species:Rattus norvegicus


Alignment Length:172 Identity:39/172 - (22%)
Similarity:71/172 - (41%) Gaps:53/172 - (30%)


- Green bases have known domain annotations that are detailed below.


  Fly   103 ILQDVETLSDIPHDITNVELQGEIAIAEGRATTIYV-QRDGLSTLTVVLHQHEPTIAQLKRAIAL 166
            ::|| ..|.|:|..:|..|:..:||:..|:|.|:.| :.|| ..:.||:.|: .|:..||:|   
  Rat     2 VVQD-PLLCDLPIQVTLEEVNSQIALEYGQAMTVRVCKMDG-EVMPVVVVQN-ATVLDLKKA--- 60

  Fly   167 ISRAQHKRSQRERCEERLRRRGIADDSDERRQPVAVASSTGELVHSAQRNGHDHRAFVSWRFLWR 231
            |.|....:.:||                                     .|..|   :||.::||
  Rat    61 IQRYVQLKQERE-------------------------------------GGVQH---ISWSYVWR 85

  Fly   232 CFGLLNVDTNQPIDDQRSSGRATLKELGIENAATLKFVHRVK 273
            .:.|.:.      .::.:..|..|::.||.|...:.|:.:::
  Rat    86 TYHLTSA------GEKLTEDRKKLRDYGIRNRDEVSFIKKLR 121

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34313NP_001097169.1 None
Snrnp25XP_006246141.1 Ubl_SNRNP25 31..119 CDD:340578 29/138 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0006151
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
11.000

Return to query results.
Submit another query.