DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34313 and F36D1.8

DIOPT Version :9

Sequence 1:NP_001097169.1 Gene:CG34313 / 5740766 FlyBaseID:FBgn0085342 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_492891.1 Gene:F36D1.8 / 185350 WormBaseID:WBGene00009467 Length:329 Species:Caenorhabditis elegans


Alignment Length:78 Identity:18/78 - (23%)
Similarity:35/78 - (44%) Gaps:12/78 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly   150 LHQHEPTIA-------QLKRAIALISRA--QHKRSQRERCEERLRRRGIADDSDERRQPVAVASS 205
            :.||...::       .:|:...|:..|  :.:||........|:|:|.::.:.|:.|..|:.  
 Worm   205 IEQHVAPLSWYCNFNENIKKYSLLMMGADLEERRSSILHLANILKRQGFSEKTVEKIQNDALG-- 267

  Fly   206 TGELVHSAQRNGH 218
             ||..||..::.|
 Worm   268 -GETAHSTHKSSH 279

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34313NP_001097169.1 None
F36D1.8NP_492891.1 Sulfotransfer_2 77..310 CDD:281554 18/78 (23%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.