DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34313 and chst-1

DIOPT Version :9

Sequence 1:NP_001097169.1 Gene:CG34313 / 5740766 FlyBaseID:FBgn0085342 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_495699.1 Gene:chst-1 / 174304 WormBaseID:WBGene00008050 Length:329 Species:Caenorhabditis elegans


Alignment Length:273 Identity:56/273 - (20%)
Similarity:95/273 - (34%) Gaps:91/273 - (33%)


- Green bases have known domain annotations that are detailed below.


  Fly    63 KKKKRKTNPRFFRTAR-RLRNDFDRSEHKAMLASTSEELRRILQDVETLSDIPHDITNVELQGEI 126
            |..|..|..||::..: ..:...||.:.:|.|:..|.....|..|.|......::|:...::..:
 Worm    30 KTVKTHTYSRFYQLIKENTKTQLDRLQEEAKLSGKSLIPPFINFDREYAIAPKYNISICRIKKSM 94

  Fly   127 A-IAEGRATTIY----VQRDGLSTLTVVLHQHEPTIAQLKRAIALISRAQHKRSQRERCEERLRR 186
            : :..|.|..:|    ..|:..|.|.|..|                 |...::::..|..|...|
 Worm    95 STLMSGVACVLYDTGKFMRNNRSILEVWSH-----------------RFCGEKNEYRRMNEVKWR 142

  Fly   187 RGIADDSDER----RQPVA--VASSTGELVHSAQR----------NGH----------------- 218
            .|.|..:.::    |.|:|  ::..:.:.:..||:          .|:                 
 Worm   143 MGDAHHTFKKIVVIRDPIARFISFFSNKCIFEAQKYPDRKQCYNCQGNVTCFLEKQYERFVQHSS 207

  Fly   219 -----------DHRAFVSWRFLWRC-FG---------LLNVDTNQPIDDQRSSGRA----TLKEL 258
                       .|.|.:|    |.| ||         .|.||   |.|  |.:|.|    .|||.
 Worm   208 DYSRIRPSYEDKHAAPLS----WNCEFGKFLKDYKIIKLAVD---PKD--RKNGLANLMNVLKES 263

  Fly   259 GIENAATLKFVHR 271
            .:.| :||:|:.:
 Worm   264 NVPN-STLRFIEK 275

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34313NP_001097169.1 None
chst-1NP_495699.1 Sulfotransfer_2 80..322 CDD:281554 43/223 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.