powered by:
Protein Alignment CG34313 and F17B5.4
DIOPT Version :9
Sequence 1: | NP_001097169.1 |
Gene: | CG34313 / 5740766 |
FlyBaseID: | FBgn0085342 |
Length: | 281 |
Species: | Drosophila melanogaster |
Sequence 2: | NP_001361849.1 |
Gene: | F17B5.4 / 173184 |
WormBaseID: | WBGene00008908 |
Length: | 309 |
Species: | Caenorhabditis elegans |
Alignment Length: | 38 |
Identity: | 9/38 - (23%) |
Similarity: | 18/38 - (47%) |
Gaps: | 0/38 - (0%) |
- Green bases have known domain annotations that are detailed below.
Fly 48 QAVREARNRNEPILGKKKKRKTNPRFFRTARRLRNDFD 85
|.:.:.|:.|:|.....:...:...||..:..::||.|
Worm 82 QYLADKRSFNDPWTSSSRDCASEKSFFDPSESVQNDKD 119
|
Known Domains:
Indicated by green bases in alignment.
Gene | Sequence | Domain | Region |
External ID | Identity |
CG34313 | NP_001097169.1 |
None |
F17B5.4 | NP_001361849.1 |
Sulfotransfer_2 |
52..286 |
CDD:367564 |
9/38 (24%) |
Information from Original Tools:
Tool |
Simple Score |
Weighted Score |
Original Tool Information |
BLAST Result |
Score |
Score Type |
Cluster ID |
Compara |
0 | 0.000 |
Not matched by this tool. |
Domainoid |
0 | 0.000 |
Not matched by this tool. |
eggNOG |
1 |
0.900 |
- |
- |
|
E1_KOG4651 |
Hieranoid |
0 | 0.000 |
Not matched by this tool. |
Homologene |
0 | 0.000 |
Not matched by this tool. |
Inparanoid |
0 | 0.000 |
Not matched by this tool. |
Isobase |
0 | 0.000 |
Not matched by this tool. |
OMA |
0 | 0.000 |
Not matched by this tool. |
OrthoDB |
0 | 0.000 |
Not matched by this tool. |
OrthoFinder |
0 | 0.000 |
Not matched by this tool. |
OrthoInspector |
0 | 0.000 |
Not matched by this tool. |
orthoMCL |
0 | 0.000 |
Not matched by this tool. |
Panther |
0 | 0.000 |
Not matched by this tool. |
Phylome |
0 | 0.000 |
Not matched by this tool. |
RoundUp |
0 | 0.000 |
Not matched by this tool. |
SonicParanoid |
0 | 0.000 |
Not matched by this tool. |
SwiftOrtho |
0 | 0.000 |
Not matched by this tool. |
TreeFam |
0 | 0.000 |
Not matched by this tool. |
|
1 | 0.900 |
|
Return to query results.
Submit another query.