DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34313 and CHST13

DIOPT Version :9

Sequence 1:NP_001097169.1 Gene:CG34313 / 5740766 FlyBaseID:FBgn0085342 Length:281 Species:Drosophila melanogaster
Sequence 2:NP_690849.1 Gene:CHST13 / 166012 HGNCID:21755 Length:341 Species:Homo sapiens


Alignment Length:262 Identity:53/262 - (20%)
Similarity:79/262 - (30%) Gaps:96/262 - (36%)


- Green bases have known domain annotations that are detailed below.


  Fly    67 RKTNPRFFRTARRLRNDFDRSEHKAMLASTSEELRRILQDVETLSDIPHDI----------TN-- 119
            |.|..:..|..|.|.|.......:.......|:||.:      |.|..|.:          ||  
Human    63 RSTLAKVHRQRRDLLNSACSRHSRRQRLLQPEDLRHV------LVDDAHGLLYCYVPKVACTNWK 121

  Fly   120 ---VELQGEI-----------AIAEGRATTI------YVQRDGLSTLTVVLHQHEP---TIAQLK 161
               :.|.|:.           |.|.||..::      .:.| .|......|...||   ..:..:
Human   122 RVLLALSGQARGDPRAISAQEAHAPGRLPSLADFSPAEINR-RLRAYLAFLFVREPFERLASAYR 185

  Fly   162 RAIALISRAQHKRSQRERCEERLRRRGIADDSDERRQPVAVASSTGELVHSAQRNGHDHR--AFV 224
            ..:|....|..:|....|..:|||.|.:.|                     |:..|||.|  .|:
Human   186 NKLARPYSAAFQRRYGARIVQRLRPRALPD---------------------ARARGHDVRFAEFL 229

  Fly   225 SWRFLWRCFGLLNVDT--NQPIDDQRSSGRA----------------TLKE-----LGIENAATL 266
            ::        ||:..|  .:|.::......|                ||.|     ||:..|:.|
Human   230 AY--------LLDPRTRREEPFNEHWERAHALCHPCRLRYDVVGKFETLAEDAAFVLGLAGASDL 286

  Fly   267 KF 268
            .|
Human   287 SF 288

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34313NP_001097169.1 None
CHST13NP_690849.1 Sulfotransfer_2 102..332 CDD:281554 43/217 (20%)
Cell attachment site. /evidence=ECO:0000255 132..134 0/1 (0%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_KOG4651
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
SwiftOrtho 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
User_Submission 00.000 Not matched by this tool.
10.900

Return to query results.
Submit another query.