DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34445 and CG13516

DIOPT Version :10

Sequence 1:NP_001097420.1 Gene:CG34445 / 5740761 FlyBaseID:FBgn0085474 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001033966.1 Gene:CG13516 / 3885599 FlyBaseID:FBgn0040658 Length:168 Species:Drosophila melanogaster


Alignment Length:86 Identity:28/86 - (32%)
Similarity:38/86 - (44%) Gaps:12/86 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly    45 LNLPREPVEIECPACGIKDLSVVQNDLKWWASELNRIVGCL-FVTFCCCCCFNYYVPCKQTDR-- 106
            |:|......:.|||||....:.:.:...   |..:.:.|.| .|.||||.||..|  |..:.|  
  Fly    88 LHLGPNRSRVLCPACGANKTTRMTHTAN---SRTHMVAGLLCLVGFCCCACFVPY--CMNSCRTG 147

  Fly   107 SHYCGNC----GCYFGRSMKR 123
            :|||..|    |.|..:.|.|
  Fly   148 NHYCRKCNTFLGAYNPKGMNR 168

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34445NP_001097420.1 zf-LITAF-like 49..119 CDD:463165 24/76 (32%)
CG13516NP_001033966.1 zf-LITAF-like 92..162 CDD:463165 23/74 (31%)

Return to query results.
Submit another query.