DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34445 and CG4250

DIOPT Version :10

Sequence 1:NP_001097420.1 Gene:CG34445 / 5740761 FlyBaseID:FBgn0085474 Length:134 Species:Drosophila melanogaster
Sequence 2:NP_001246468.1 Gene:CG4250 / 37599 FlyBaseID:FBgn0034761 Length:134 Species:Drosophila melanogaster


Alignment Length:71 Identity:21/71 - (29%)
Similarity:35/71 - (49%) Gaps:9/71 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly    51 PVEIECPACGIKDLSVVQNDLKWWASELNRIVGCLFVTFCCCCCFNYYVP-CKQTDRS--HYCGN 112
            |....||:||::..:.|:.:.. ..:.|..::.|:....||||     :| |..:.:|  |.|.:
  Fly    66 PSVATCPSCGVRRETKVEFEPS-TKTHLLALLICMLGGICCCC-----IPYCTDSCQSAKHTCTS 124

  Fly   113 CGCYFG 118
            ||.|.|
  Fly   125 CGAYVG 130

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34445NP_001097420.1 zf-LITAF-like 49..119 CDD:463165 21/71 (30%)
CG4250NP_001246468.1 zf-LITAF-like 66..133 CDD:463165 21/71 (30%)

Return to query results.
Submit another query.