DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34316 and CG11852

DIOPT Version :9

Sequence 1:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_651357.1 Gene:CG11852 / 43035 FlyBaseID:FBgn0039297 Length:250 Species:Drosophila melanogaster


Alignment Length:263 Identity:51/263 - (19%)
Similarity:96/263 - (36%) Gaps:63/263 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly    12 LATAILYACLSPAA----------------CVYEAKILAFLQEFRMRMCHPIPNLGLPALDPLQL 60
            |....|:.||...|                |:.....:...|..|.    ..|:.|.|.::|..:
  Fly     6 LGCVALFCCLVSGASNFPPELPRCHMGDTSCIINVSHMLIRQHART----GYPSAGFPQVEPFLI 66

  Fly    61 GPAETELNNKYLVDFTGSID---NFQ---LHGLSD--FD-------VPALSLSPVPGLKNTINVT 110
            ...:.....      |||::   ||:   :.|||.  ||       .||.|...:.|       :
  Fly    67 KRFDISDGR------TGSLNLKLNFRDVNVEGLSSVKFDRAVGFGADPATSKFEMYG-------S 118

  Fly   111 LPLTYFKSLYTAKGSLAYILNLAGDGNAETSITNFSILISFR-----LRSVSPLAISSLQIELRL 170
            .|....|..|.|.|.: .||.:.|||:||..:.|....:.|:     ....:.|::..|::.:..
  Fly   119 FPKIVLKGKYVADGRI-LILPIRGDGDAEIVLHNPKFSVKFKPGTQQRNGRTYLSVDKLKVLVEP 182

  Fly   171 GGLWINFDNLMEEDR-----INDFIHALVNEMGVELLGDVWDYEQGTVVSKVQAAVNNFLGQYSL 230
            ..:.|..:||...|:     :|.|:    |:...|:..::.......:...:::.::....:::.
  Fly   183 QKMNIRLENLFNGDQALGTNLNQFL----NDNWTEVWNELHPSIHVAIAEIMKSVLSQLFKRFAY 243

  Fly   231 SDI 233
            .|:
  Fly   244 EDL 246

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 44/223 (20%)
CG11852NP_651357.1 JHBP 9..248 CDD:284096 50/260 (19%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470563
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.