DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34316 and CG31189

DIOPT Version :9

Sequence 1:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_732580.3 Gene:CG31189 / 42487 FlyBaseID:FBgn0051189 Length:258 Species:Drosophila melanogaster


Alignment Length:197 Identity:50/197 - (25%)
Similarity:75/197 - (38%) Gaps:37/197 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    47 IPNLGLPALDPLQLGPA---ETELNNKYLVDFTGSIDNFQLHGLSDFDVPALSLSPVPGL----- 103
            ||.:|||.||......:   |:.......:||. ..||.. .|.::     .:::.|.|.     
  Fly    53 IPEIGLPPLDAYNFPDSVIMESPSRGPIWMDFR-MRDNVN-KGFNN-----ATITHVEGFLYEPN 110

  Fly   104 --KNTINVTLPLTYFKSLYTAKGS-LAYILNLAGDGNAETSITNFSI------LISFRLRSVSPL 159
              :..:.|.||....::.|...|. |.:..|..  |...:...||.|      |:.:| .....|
  Fly   111 QKQIVLKVRLPRLVHEATYDMSGRVLLFFFNTT--GRLISDFQNFRITLTIKALVEYR-NDKRYL 172

  Fly   160 AISSLQIELRLGGLWINFDNLMEEDR-INDFIHALVNEMGVELLGDVW-DYEQGTVVSKVQAAVN 222
            .|.:|...|.|....|..|.|.:|:. :..|::.|.||..||.    | |.:.|.    |:|..|
  Fly   173 KIYNLVPSLDLDRWIIWLDGLYKENTDVTIFMNKLFNENWVEF----WNDLQPGL----VKAFTN 229

  Fly   223 NF 224
            .|
  Fly   230 AF 231

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 50/197 (25%)
CG31189NP_732580.3 JHBP 9..249 CDD:284096 50/197 (25%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470579
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.