DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34316 and CG10264

DIOPT Version :9

Sequence 1:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_650518.1 Gene:CG10264 / 41948 FlyBaseID:FBgn0038394 Length:270 Species:Drosophila melanogaster


Alignment Length:182 Identity:43/182 - (23%)
Similarity:81/182 - (44%) Gaps:17/182 - (9%)


- Green bases have known domain annotations that are detailed below.


  Fly    44 CHP-----IPNLGLPALDPLQLGPAETELNNKYLVDFTGSIDNFQLHGLSDFDVPALSLSPVPGL 103
            |.|     ||.:|:.:.:||.:........:..|| .:|...:..:.|.|:..|...||.....|
  Fly    69 CFPALAAGIPEIGVKSFEPLNIDQVSVSKGSGNLV-LSGGFQDLVIRGPSNATVRRASLDLERRL 132

  Fly   104 KNTINVTLPLTYFKSLYTAKGSLAYILNLAGDGNAETSITNFSILISFR--LRSVSP-----LAI 161
            .| ..:.||....::.|..||:: .:|.|.|.|:...::.|....:..|  ||:.:.     :.|
  Fly   133 LN-FELELPRLRIRAKYNLKGNI-LLLPLVGSGDVAMALKNVHTTVYTRISLRNETRTGDEIIHI 195

  Fly   162 SSLQIELRLGGLWINFDNLMEEDRI-NDFIHALVNEMGVELLGDVW-DYEQG 211
            ..:::...:|.:.|:..||...:.| ...|::.:|:.|.|::.::. |.|.|
  Fly   196 DEMKVGFDVGAMRIHLKNLFNGNEILAASINSFLNQNGKEVIAELRPDLELG 247

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 43/182 (24%)
CG10264NP_650518.1 JHBP 42..270 CDD:214779 43/182 (24%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470587
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.