DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34316 and CG1124

DIOPT Version :9

Sequence 1:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_649509.1 Gene:CG1124 / 40613 FlyBaseID:FBgn0037290 Length:246 Species:Drosophila melanogaster


Alignment Length:167 Identity:35/167 - (20%)
Similarity:72/167 - (43%) Gaps:31/167 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    36 LQEFRMRMCHPIPNLGLPALDPLQLGPAETELN---NKYLVDFTGSIDNFQLHGLSDFDVPALSL 97
            ::..:..:.:.||::.||:::|.::.....:|.   ..|.:    ::.|.:..|.|:|.|.:|.|
  Fly    43 IEHLKPYLANGIPDIQLPSVEPFKMDTLALQLTEGPQGYKI----TLKNMEAFGASNFKVTSLKL 103

  Fly    98 S----PVPGLKNTINVTLPLTYFKSLYTAKGSLAYILNLAGDGN-------------AETSITNF 145
            |    |...     .:.:|....::.||:.|.| .||..:|.|:             .:|||..|
  Fly   104 SEGSEPFKA-----KIVMPKLKIEAKYTSSGVL-LILPASGGGDFHANFEGVSADLTGKTSIHAF 162

  Fly   146 SILISFRLRSVSPLAISSLQIELRLGGLWINFDNLME 182
            .......:.::| |.:....:::.:.|.:.|...|:|
  Fly   163 KGANYLHIDALS-LVLDVKDVKMSISGAFNNNRILLE 198

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 35/167 (21%)
CG1124NP_649509.1 JHBP 6..244 CDD:284096 35/167 (21%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470591
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.