DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34316 and CG2016

DIOPT Version :9

Sequence 1:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001262270.1 Gene:CG2016 / 40612 FlyBaseID:FBgn0250839 Length:254 Species:Drosophila melanogaster


Alignment Length:241 Identity:47/241 - (19%)
Similarity:89/241 - (36%) Gaps:79/241 - (32%)


- Green bases have known domain annotations that are detailed below.


  Fly    29 EAKILAFLQEFRMRMCHPIPNLGLPALDPLQLGPAETELNNKYLVDFTGSI------------DN 81
            ||:|...|:|...::.|.:.. |:|.||..::.|.        ::|..|.:            .|
  Fly    33 EAQINECLRESGNKLVHYLQK-GVPELDIYEIEPV--------MIDEIGIVLGSGPDGYRALFRN 88

  Fly    82 FQLHGLSDFDVPALSLSPVPGLKNTINVTLPLTYFKSLYTAKGSL-------------------- 126
            .|.:|:|:..|..:. |.:..|:..:...:|....|:.|.:.|.|                    
  Fly    89 IQAYGVSNITVTNIR-SDLDSLQFQLTCEIPRIRVKAQYRSTGVLILVKASGAGDYWGEYEGVKA 152

  Fly   127 -AYILNLAGDG-NAETSITNFSILISFRLRSVSPLAISSLQIELRLGGLWINFDNLME------- 182
             .|...:|.:| :..|.:|..|:.:.|.::            |:::|     .||:..       
  Fly   153 KIYFKAVANEGPDGRTYLTTDSVKMDFNVK------------EIQMG-----VDNIANGNTVILL 200

  Fly   183 ---EDRINDFIHALVNEMGVELLGDVWDYEQGTVVSKVQAAVNNFL 225
               |..:|.||    |....|||.::    :..:.:|:...:.||:
  Fly   201 SSTEAALNLFI----NSNSQELLKEM----KPALRTKLTLVIRNFM 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 45/238 (19%)
CG2016NP_001262270.1 JHBP 7..251 CDD:284096 47/241 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45470571
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR11008
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
32.940

Return to query results.
Submit another query.