DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34316 and CG7953

DIOPT Version :9

Sequence 1:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_001285913.1 Gene:CG7953 / 34801 FlyBaseID:FBgn0028533 Length:297 Species:Drosophila melanogaster


Alignment Length:238 Identity:52/238 - (21%)
Similarity:99/238 - (41%) Gaps:17/238 - (7%)


- Green bases have known domain annotations that are detailed below.


  Fly    35 FLQEFRMRMCHPIPNLGLPALDPLQLGPAETELN-NKYLVDFTGSIDNFQLHGLSDFDVPALSLS 98
            |:::.:.:|....|..|:|.|.||::.  |.:|: .|.:.:....:...::.||:||::....|:
  Fly    62 FIRKLQKQMECGWPQYGIPVLAPLRIN--EFDLDYKKGIFETLNHVFRLKIAGLNDFNIQKFKLN 124

  Fly    99 PVPG------LKNTINVTLPLTYFKSLYTAKGSLAYILNLAGDGNAETSITNFSI--LISFRLRS 155
            .:..      |...|:.|.......:|..|...|...:...|.|.....:.|..|  .:.::|..
  Fly   125 VITSKITFDFLFKNIDTTAQKYDTDTLIDALRQLGLSVEYEGSGELLFDLVNLRIAGTLKYKLPM 189

  Fly   156 V-SPLAISSLQIELRLGGLWINFDNLMEEDRINDFIHALVNEMGVELLGDVWDYEQGTVVSKVQA 219
            : ....|:||:..:.|..:..:....|...:||..|::.:..:.|:.:....|....|:.:.:..
  Fly   190 LWGSAKITSLKTTISLESVTSDITGFMGNGKINRAINSQLENIVVKGINGNQDAISETIENAIVP 254

  Fly   220 AVNNFLGQYSLSDIIQIII-GGDGEGESAPIFDGVEPDCKPDA 261
            .||..|.......::.:|: ..|||.|..||.    .||.|.|
  Fly   255 RVNKMLKGKDFWTVVDLILASSDGESEDDPIV----VDCDPSA 293

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 41/205 (20%)
CG7953NP_001285913.1 JHBP 44..268 CDD:214779 41/207 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZNH
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130697at6960
OrthoFinder 1 1.000 - - FOG0008542
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.