DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment CG34316 and CG33306

DIOPT Version :9

Sequence 1:NP_001097798.1 Gene:CG34316 / 5740757 FlyBaseID:FBgn0085345 Length:267 Species:Drosophila melanogaster
Sequence 2:NP_995706.1 Gene:CG33306 / 2768915 FlyBaseID:FBgn0053306 Length:244 Species:Drosophila melanogaster


Alignment Length:258 Identity:60/258 - (23%)
Similarity:117/258 - (45%) Gaps:36/258 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 LTSQVLLATAI-LYAC--------LSPAACVYEAKILAFLQEFRMRMCHPIPNLGLPALDPLQLG 61
            :.|..|:|..: |.:|        ||.....:.:.|:..|:.||:.:.:..|..|:|.:.|::..
  Fly     1 MKSAFLIALIVALASCQGAEVAEPLSAQGRSFSSVIVDGLEAFRVVLQNGSPRFGIPVMAPMKAA 65

  Fly    62 PAETELNNKYLVDFTGS--IDNFQLHGLSDFDVPALSLSPVPGLKNTINVTLPLTYFKSLYTAKG 124
            ....|:|:.   :|:|:  ::||:|.||..:::..:::..:.. :.|.|:......|.:.|....
  Fly    66 QRSFEINSG---EFSGTFGVENFELQGLDQYEIITMNMDVIRS-RLTFNINFASLNFTTDYEMDM 126

  Fly   125 SLAYILNLAGDGNAETSITNFSI--LISFRLR-SVSPLAISSLQIELRLGGLWINFDNLME---- 182
            ...|  .:..:|.|..::.:.:|  .||:.|. ..|.|.:..:.|...:|.:....:||.:    
  Fly   127 GSGY--RIKRNGGAFFALEDLNIQGRISYSLGVFTSQLRVKDVLIYPSVGNVNSQIENLSKYRIF 189

  Fly   183 ----EDRINDFIHALVNEMGVELLGDVWDYEQGTVVSKVQAAVNNFLGQYSLSDIIQIIIGGD 241
                .:.|.:|:...:|| ..:.:. .|..||.|.:      .|:.:|..:|||||.||.||:
  Fly   190 NRKLNEIIEEFVTLTINE-NTDFVA-AWVSEQATPI------CNDLIGDRTLSDIIAIITGGN 244

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
CG34316NP_001097798.1 JHBP 32..231 CDD:299906 44/211 (21%)
CG33306NP_995706.1 JHBP 16..230 CDD:299906 46/227 (20%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2CZNH
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130697at6960
OrthoFinder 1 1.000 - - FOG0008542
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.820

Return to query results.
Submit another query.