DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and Cpr65Ax2

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001261467.1 Gene:Cpr65Ax2 / 59157 FlyBaseID:FBgn0042118 Length:102 Species:Drosophila melanogaster


Alignment Length:102 Identity:102/102 - (100%)
Similarity:102/102 - (100%) Gaps:0/102 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAIVLFALFAVALAAPTVEVLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAISTH 65
            |||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
  Fly     1 MKFAIVLFALFAVALAAPTVEVLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAISTH 65

  Fly    66 GSFSYVGPDGQTYTVTYVADENGFQPQGAHLPVAPVA 102
            |||||||||||||||||||||||||||||||||||||
  Fly    66 GSFSYVGPDGQTYTVTYVADENGFQPQGAHLPVAPVA 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 54/54 (100%)
Cpr65Ax2NP_001261467.1 Chitin_bind_4 34..89 CDD:278791 54/54 (100%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466850
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.840

Return to query results.
Submit another query.