DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and AgaP_AGAP000745

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_001689397.2 Gene:AgaP_AGAP000745 / 5666781 VectorBaseID:AGAP000745 Length:600 Species:Anopheles gambiae


Alignment Length:83 Identity:26/83 - (31%)
Similarity:40/83 - (48%) Gaps:15/83 - (18%)


- Green bases have known domain annotations that are detailed below.


  Fly    17 APTVEVLRSDSNVGID-NYSYAVETSDGTSKSEEGVLKNAGTELEAISTHGSFSYVGPDGQTYTV 80
            ||.|:.:|:.|.|..| ::::..|.:||:.|.|     ..||:   ....|.:.|:.|||.....
Mosquito   122 APPVQTIRNYSKVNDDGSFTFGYEAADGSFKEE-----TRGTD---CVVRGKYGYIDPDGNKREF 178

  Fly    81 TYVA----DENGFQPQGA 94
            |||:    |.|  .|.|:
Mosquito   179 TYVSGNPCDPN--NPDGS 194

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 17/58 (29%)
AgaP_AGAP000745XP_001689397.2 Chitin_bind_4 140..183 CDD:278791 15/50 (30%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.