DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and Lcp65Ab1

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_524814.2 Gene:Lcp65Ab1 / 48382 FlyBaseID:FBgn0020644 Length:104 Species:Drosophila melanogaster


Alignment Length:104 Identity:64/104 - (61%)
Similarity:80/104 - (76%) Gaps:2/104 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAIVLFALFAVALAAPTV-EVLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAIST 64
            |||.||..||||:|:|.|.: |::|..|:|..:.:|..||||||||..:|||||||||:.||...
  Fly     1 MKFLIVFVALFAMAVARPNLAEIVRQVSDVEPEKWSSDVETSDGTSIKQEGVLKNAGTDNEAAVV 65

  Fly    65 HGSFSYVG-PDGQTYTVTYVADENGFQPQGAHLPVAPVA 102
            ||||::|. ..|:.:|:||||||||:|||||||||||||
  Fly    66 HGSFTWVDEKTGEKFTITYVADENGYQPQGAHLPVAPVA 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 34/55 (62%)
Lcp65Ab1NP_524814.2 Chitin_bind_4 40..91 CDD:306811 32/50 (64%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466914
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 1 1.000 - - FOG0005922
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 00.000 Not matched by this tool.
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
54.930

Return to query results.
Submit another query.