DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and CPR153

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_001238070.3 Gene:CPR153 / 4578106 VectorBaseID:AGAP009873 Length:334 Species:Anopheles gambiae


Alignment Length:69 Identity:31/69 - (44%)
Similarity:38/69 - (55%) Gaps:0/69 - (0%)


- Green bases have known domain annotations that are detailed below.


  Fly    32 DNYSYAVETSDGTSKSEEGVLKNAGTELEAISTHGSFSYVGPDGQTYTVTYVADENGFQPQGAHL 96
            |.|.|.....:....:|.|.:.:..||.|.:...|.:.|:|.|||.|.|.||||||||||.|.||
Mosquito   247 DGYYYKYANENNIEAAESGKIDDRNTENETLRAKGYYEYIGDDGQKYRVDYVADENGFQPLGDHL 311

  Fly    97 PVAP 100
            |..|
Mosquito   312 PTPP 315

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 21/54 (39%)
CPR153XP_001238070.3 Chitin_bind_4 249..304 CDD:278791 21/54 (39%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.