DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and CPR115

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_001230823.2 Gene:CPR115 / 4576978 VectorBaseID:AGAP003377 Length:186 Species:Anopheles gambiae


Alignment Length:101 Identity:35/101 - (34%)
Similarity:42/101 - (41%) Gaps:17/101 - (16%)


- Green bases have known domain annotations that are detailed below.


  Fly     9 ALFAVA-LAAPTVEVLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAISTHGSFSYVG 72
            |..||| :|||..:...|      ..|||:...:|..:    |..||...........||:|.|.
Mosquito    64 APLAVAKVAAPYADYDAS------PQYSYSYAVADAVT----GDNKNQQESRSGDVVTGSYSLVE 118

  Fly    73 PDGQTYTVTYVADE-NGFQPQGAHLP-----VAPVA 102
            |||...||.|.||. |||.......|     |||:|
Mosquito   119 PDGTRRTVEYNADPINGFNAVVHREPLAVKAVAPIA 154

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 20/55 (36%)
CPR115XP_001230823.2 Chitin_bind_4 84..136 CDD:278791 20/55 (36%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
10.910

Return to query results.
Submit another query.