DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and Lcp65Ae

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_788468.1 Gene:Lcp65Ae / 45018 FlyBaseID:FBgn0020640 Length:99 Species:Drosophila melanogaster


Alignment Length:99 Identity:52/99 - (52%)
Similarity:71/99 - (71%) Gaps:1/99 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAIVLFALFAVALAAPTVEVLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAISTH 65
            |||.||..|:||.|| |...:::..:|:||.:|:.::.|||||.:.:.:|.||...|:.|:::..
  Fly     1 MKFLIVFVAIFAFAL-ANEAQIINLESDVGPENFQWSFETSDGQAANAKGQLKYPNTDHESLAVQ 64

  Fly    66 GSFSYVGPDGQTYTVTYVADENGFQPQGAHLPVA 99
            |||.:|..|||||.|.|:||||||||||||||||
  Fly    65 GSFRFVADDGQTYEVNYIADENGFQPQGAHLPVA 98

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 25/54 (46%)
Lcp65AeNP_788468.1 Chitin_bind_4 33..88 CDD:278791 25/54 (46%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466920
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 1 1.000 - - FOG0005922
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.950

Return to query results.
Submit another query.