DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and Acp65Aa

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_477282.2 Gene:Acp65Aa / 38710 FlyBaseID:FBgn0020765 Length:105 Species:Drosophila melanogaster


Alignment Length:103 Identity:56/103 - (54%)
Similarity:74/103 - (71%) Gaps:6/103 - (5%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAIV---LFALFAVALAAP--TVEVLRSDS-NVGIDNYSYAVETSDGTSKSEEGVLKNAGTEL 59
            ||..:|   :..|.|:|.|.|  .||||..:| |.|:..|.::.:.|||||::||||:.||||:.
  Fly     2 MKLMLVVGSIALLLALASARPQNDVEVLEYESENTGLGGYKFSYKLSDGTSRTEEGVVNNAGTDN 66

  Fly    60 EAISTHGSFSYVGPDGQTYTVTYVADENGFQPQGAHLP 97
            |:||..||.::|.|||||||:.:|||||||||:|||||
  Fly    67 ESISIRGSVTWVAPDGQTYTINFVADENGFQPEGAHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 32/54 (59%)
Acp65AaNP_477282.2 Chitin_bind_4 41..96 CDD:278791 32/54 (59%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466852
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27015
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
65.860

Return to query results.
Submit another query.