DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and Lcp65Ad

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_001261466.1 Gene:Lcp65Ad / 38707 FlyBaseID:FBgn0020641 Length:108 Species:Drosophila melanogaster


Alignment Length:104 Identity:59/104 - (56%)
Similarity:73/104 - (70%) Gaps:7/104 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKF--AIVLFALFAVALAAP-----TVEVLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTE 58
            |||  ||....:.|.:||||     ..:|||.||:|..:.|.:|||||||.|..|||.||:.||:
  Fly     1 MKFTIAIAFTCILACSLAAPPAIQQDAQVLRFDSDVLPEGYKFAVETSDGKSHQEEGQLKDVGTD 65

  Fly    59 LEAISTHGSFSYVGPDGQTYTVTYVADENGFQPQGAHLP 97
            .|||...||::|||.|||||::.|:||||||||:|||||
  Fly    66 HEAIVVRGSYAYVGDDGQTYSIQYLADENGFQPEGAHLP 104

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 34/54 (63%)
Lcp65AdNP_001261466.1 Chitin_bind_4 41..96 CDD:278791 34/54 (63%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 1 0.930 - - C45466923
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27015
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 1 1.000 - - FOG0005922
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
87.860

Return to query results.
Submit another query.