DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and Lcp9

DIOPT Version :10

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_523854.1 Gene:Lcp9 / 37963 FlyBaseID:FBgn0025578 Length:92 Species:Drosophila melanogaster


Alignment Length:92 Identity:36/92 - (39%)
Similarity:51/92 - (55%) Gaps:4/92 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAIVLFALFAVALAAPTVEVLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAISTH 65
            |||.|||..|.||..|....:|::|||.|.:.:::||.|.|:.....:.|.||    |.:.....
  Fly     1 MKFVIVLACLLAVVFANEEADVVKSDSEVNLLDFNYAYELSNHIRAVQTGALK----EHDNWVVS 61

  Fly    66 GSFSYVGPDGQTYTVTYVADENGFQPQ 92
            |.:.||.|:|:|..|.|.|||.|:.|:
  Fly    62 GEYEYVAPNGKTVKVVYTADETGYHPK 88

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:459790 19/54 (35%)
Lcp9NP_523854.1 Chitin_bind_4 34..85 CDD:459790 19/54 (35%)

Return to query results.
Submit another query.