DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and Cpr49Ab

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_610769.1 Gene:Cpr49Ab / 36345 FlyBaseID:FBgn0050042 Length:259 Species:Drosophila melanogaster


Alignment Length:102 Identity:39/102 - (38%)
Similarity:52/102 - (50%) Gaps:16/102 - (15%)


- Green bases have known domain annotations that are detailed below.


  Fly    14 ALAAPTVE---------------VLRSDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAIS 63
            |:|.||..               ::|.:.:|.:|.|.|..||.:|....|.|.::.. ||.|.:.
  Fly   138 AIADPTANLPKGRGTGEGGNGWAIIRQEDDVEVDGYHYLWETENGILGEESGRIEKL-TEEEGLR 201

  Fly    64 THGSFSYVGPDGQTYTVTYVADENGFQPQGAHLPVAP 100
            :.|.:.|.||||..|.|.||||:|||.|..||||.||
  Fly   202 SKGFYEYTGPDGILYRVDYVADDNGFVPSAAHLPTAP 238

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 23/54 (43%)
Cpr49AbNP_610769.1 Chitin_bind_4 173..227 CDD:278791 23/54 (43%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
22.010

Return to query results.
Submit another query.