DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and CPR105

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_556684.2 Gene:CPR105 / 3290086 VectorBaseID:AGAP006010 Length:105 Species:Anopheles gambiae


Alignment Length:103 Identity:39/103 - (37%)
Similarity:55/103 - (53%) Gaps:15/103 - (14%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAIVLFALFAVALAAPTVEV-LRSDSNVGID-------NYSYAVETSDGTSKSEEGVLKNA-- 55
            ||..|||.||.|||..||..:: ||   |:.||       :||::.:.:|...:.|..|||..  
Mosquito     1 MKCLIVLAALIAVAACAPQGDIALR---NLDIDHAGLVDGSYSFSYDQTDDHKREESAVLKTVKN 62

  Fly    56 --GTELEAISTHGSFSYVGPDGQTYTVTYVADENGFQP 91
              ..::.|::..|.:.:..|||:.|.|.|.||||||.|
Mosquito    63 FDNEDVPALTITGQYEFTDPDGKRYLVKYTADENGFNP 100

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 19/58 (33%)
CPR105XP_556684.2 Chitin_bind_4 39..98 CDD:278791 19/58 (33%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D143498at6960
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
32.820

Return to query results.
Submit another query.