DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and Cpr11B

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:NP_572807.1 Gene:Cpr11B / 32203 FlyBaseID:FBgn0030398 Length:197 Species:Drosophila melanogaster


Alignment Length:84 Identity:35/84 - (41%)
Similarity:52/84 - (61%) Gaps:2/84 - (2%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PTVEVLRSDSNVGID-NYSYAVETSDGTSKSEEGVLKNAGTELEAISTHGSFSYVGPDGQTYTVT 81
            |.:.::|||.|...: ||::..:|.:|..:.|.|..: .|....::...||:||.|.||:.|||.
  Fly    68 PQIPIVRSDYNSDANGNYNFGFDTGNGIHRDETGEFR-GGWPHGSLGVQGSYSYTGDDGKQYTVN 131

  Fly    82 YVADENGFQPQGAHLPVAP 100
            |.||:|||..:||||||:|
  Fly   132 YTADKNGFHAEGAHLPVSP 150

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 20/54 (37%)
Cpr11BNP_572807.1 Chitin_bind_4 85..139 CDD:278791 20/54 (37%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Compara 00.000 Not matched by this tool.
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
Isobase 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D1508073at2759
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
orthoMCL 00.000 Not matched by this tool.
Panther 1 1.100 - - P PTHR10380
Phylome 1 0.910 - -
RoundUp 00.000 Not matched by this tool.
SonicParanoid 00.000 Not matched by this tool.
43.920

Return to query results.
Submit another query.