DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and LOC1279296

DIOPT Version :10

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_318997.6 Gene:LOC1279296 / 1279296 VectorBaseID:AGAMI1_012778 Length:386 Species:Anopheles gambiae


Alignment Length:84 Identity:42/84 - (50%)
Similarity:56/84 - (66%) Gaps:1/84 - (1%)


- Green bases have known domain annotations that are detailed below.


  Fly    18 PTVEVLRSDS-NVGIDNYSYAVETSDGTSKSEEGVLKNAGTELEAISTHGSFSYVGPDGQTYTVT 81
            |.:|::..:: |.|...|.|:.||::|....|:|.:||.|::.|..|..||:||..||||..|||
Mosquito   167 PPIEIISYENMNNGDGTYKYSYETANGIKVQEQGEIKNKGSDNEIPSVQGSYSYTAPDGQVITVT 231

  Fly    82 YVADENGFQPQGAHLPVAP 100
            |:||||||||||.|||..|
Mosquito   232 YIADENGFQPQGDHLPTPP 250

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:459790 28/54 (52%)
LOC1279296XP_318997.6 None

Return to query results.
Submit another query.