DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and CPR25

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_316040.1 Gene:CPR25 / 1276670 VectorBaseID:AGAP006000 Length:104 Species:Anopheles gambiae


Alignment Length:103 Identity:52/103 - (50%)
Similarity:67/103 - (65%) Gaps:7/103 - (6%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAIVLFAL---FAVALAAP--TVEVLRSDSNV-GIDNYSYAVETSDGTSKSEEGVLKNAGTEL 59
            ||.|::..||   .|||:..|  ..|.|:.|:|: |:|.|||..|||:|.|..|.|.||..| :.
Mosquito     1 MKCALICVALCVAAAVAIPVPDQNAETLKYDNNINGVDGYSYQYETSNGISAQEAGELKAVG-DA 64

  Fly    60 EAISTHGSFSYVGPDGQTYTVTYVADENGFQPQGAHLP 97
            .|::..||::|...|||.|||||:||||||||:|.|||
Mosquito    65 SALAVRGSYTYTAADGQVYTVTYIADENGFQPEGEHLP 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 29/54 (54%)
CPR25XP_316040.1 Chitin_bind_4 40..94 CDD:278791 29/54 (54%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27015
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
43.830

Return to query results.
Submit another query.