DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and CPR23

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_316038.1 Gene:CPR23 / 1276668 VectorBaseID:AGAP005998 Length:104 Species:Anopheles gambiae


Alignment Length:102 Identity:52/102 - (50%)
Similarity:71/102 - (69%) Gaps:5/102 - (4%)


- Green bases have known domain annotations that are detailed below.


  Fly     1 MKFAIVLFALFAVALAAPT----VEVLR-SDSNVGIDNYSYAVETSDGTSKSEEGVLKNAGTELE 60
            ||||:|..|:.|||||||.    .:||: .:.|:|:|.|::..|||:..:::|...|||.|.::.
Mosquito     1 MKFAVVFAAVLAVALAAPADERDAQVLKYENDNLGVDGYNFQYETSNNINRAETAELKNFGDDVA 65

  Fly    61 AISTHGSFSYVGPDGQTYTVTYVADENGFQPQGAHLP 97
            |:...||:||.|||||.|||.||||||||||:..|:|
Mosquito    66 ALVVRGSYSYTGPDGQVYTVNYVADENGFQPEAPHIP 102

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 28/54 (52%)
CPR23XP_316038.1 Chitin_bind_4 39..94 CDD:278791 28/54 (52%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 1 1.000 - - H43214
Inparanoid 00.000 Not matched by this tool.
OMA 1 1.010 - - QHG27015
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
54.830

Return to query results.
Submit another query.