DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and CPR16

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_315462.3 Gene:CPR16 / 1276152 VectorBaseID:AGAP005459 Length:136 Species:Anopheles gambiae


Alignment Length:96 Identity:44/96 - (45%)
Similarity:56/96 - (58%) Gaps:12/96 - (12%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLFALFAVALAA---PTVEVLRSDSNVGID-NYSYAVETSDGTSKSEEGVLKNAGTELEAISTHG 66
            |:.||.|||:|.   ...:||.|||.|..| :|.:..|||:|....|:||    |.:    |..|
Mosquito     6 VIAALAAVAVAQNPDADAQVLSSDSVVNPDGSYQWNYETSNGIRAQEQGV----GGQ----SAQG 62

  Fly    67 SFSYVGPDGQTYTVTYVADENGFQPQGAHLP 97
            |.|:...||...::||||||||:||||.|||
Mosquito    63 SASWTDRDGTPISLTYVADENGYQPQGDHLP 93

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 22/54 (41%)
CPR16XP_315462.3 Chitin_bind_4 38..85 CDD:278791 22/54 (41%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.