DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and CPR15

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_315459.4 Gene:CPR15 / 1276149 VectorBaseID:AGAP005456 Length:137 Species:Anopheles gambiae


Alignment Length:98 Identity:51/98 - (52%)
Similarity:60/98 - (61%) Gaps:13/98 - (13%)


- Green bases have known domain annotations that are detailed below.


  Fly     6 VLFALFAVALAA----PTVEVLRSDSNVGID-NYSYAVETSDGTSKSEEGVLKNAGTELEAISTH 65
            |:.||.|||.|.    ...:||.|||.|..| :|:|..|||:|.:..|.||    |.:    |..
Mosquito     6 VIAALVAVAAAQNPQDAQAQVLASDSVVNPDGSYNYRYETSNGLAAQESGV----GGQ----SAQ 62

  Fly    66 GSFSYVGPDGQTYTVTYVADENGFQPQGAHLPV 98
            ||:||.|.||..|.|:|||||||||||||||||
Mosquito    63 GSYSYTGDDGVQYQVSYVADENGFQPQGAHLPV 95

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 26/54 (48%)
CPR15XP_315459.4 Chitin_bind_4 39..86 CDD:278791 26/54 (48%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 00.000 Not matched by this tool.
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 00.000 Not matched by this tool.
21.810

Return to query results.
Submit another query.