DRSC/TRiP Functional Genomics Resources

powered by:
logo

back to: DIOPT - Ortholog Prediction Tool / DIOPT for Diseases and Traits


Protein Alignment Cpr65Ax1 and CPR8

DIOPT Version :9

Sequence 1:NP_001097523.1 Gene:Cpr65Ax1 / 5740751 FlyBaseID:FBgn0086900 Length:102 Species:Drosophila melanogaster
Sequence 2:XP_312322.1 Gene:CPR8 / 1273355 VectorBaseID:AGAP002613 Length:137 Species:Anopheles gambiae


Alignment Length:130 Identity:49/130 - (37%)
Similarity:67/130 - (51%) Gaps:31/130 - (23%)


- Green bases have known domain annotations that are detailed below.


  Fly     3 FAIVLFALFA--VALAAPT--------------VEVLR--SDSNVGIDNYSYAVETSDGTSKSEE 49
            ||.|...|.|  |.|:||.              |:.:|  |::| |:|.|.:..|.|||..:||.
Mosquito     7 FASVCCVLLAGRVVLSAPAPQQGGAPAGQNPNDVQTVRYYSENN-GLDGYKFTYELSDGQIRSEV 70

  Fly    50 GVLKNA----GTELEAISTHGSFSYVGPDGQTYTVTYVADENGFQPQGAHLPV--------APVA 102
            |..::.    |.:::|:...||:|:||||||||.|.|.|||||:.|:....|.        ||||
Mosquito    71 GTYRDVKDAEGKDVKALFVQGSYSFVGPDGQTYWVNYTADENGYHPKVGTGPTGGIQAGQDAPVA 135

  Fly   103  102
            Mosquito   136  135

Known Domains:


Indicated by green bases in alignment.

GeneSequenceDomainRegion External IDIdentity
Cpr65Ax1NP_001097523.1 Chitin_bind_4 34..89 CDD:278791 27/58 (47%)
CPR8XP_312322.1 Chitin_bind_4 55..114 CDD:278791 27/58 (47%)


Information from Original Tools:


Tool Simple Score Weighted Score Original Tool Information
BLAST Result Score Score Type Cluster ID
Domainoid 00.000 Not matched by this tool.
eggNOG 1 0.900 - - E1_2EQ63
Hieranoid 00.000 Not matched by this tool.
Homologene 00.000 Not matched by this tool.
Inparanoid 00.000 Not matched by this tool.
OMA 00.000 Not matched by this tool.
OrthoDB 1 1.010 - - D130920at33392
OrthoFinder 00.000 Not matched by this tool.
OrthoInspector 00.000 Not matched by this tool.
Panther 00.000 Not matched by this tool.
Phylome 1 0.910 - -
SonicParanoid 00.000 Not matched by this tool.
TreeFam 1 0.960 - -
43.780

Return to query results.
Submit another query.